Class b: All beta proteins [48724] (176 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.1: TNF-like [49843] (15 proteins) |
Protein Tumor necrosis factor (TNF) [49848] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49849] (13 PDB entries) |
Domain d4g3yc_: 4g3y C: [196713] Other proteins in same PDB: d4g3yl1, d4g3yl2 automated match to d1a8ma_ |
PDB Entry: 4g3y (more details), 2.6 Å
SCOPe Domain Sequences for d4g3yc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g3yc_ b.22.1.1 (C:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]} dkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkgqgc psthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlekg drlsaeinrpdyldfaesgqvyfgiial
Timeline for d4g3yc_: