Lineage for d1dxrc_ (1dxr C:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101664Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
  4. 101665Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
  5. 101704Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein)
  6. 101705Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 101706Species Rhodopseudomonas viridis [TaxId:1079] [48709] (8 PDB entries)
  8. 101707Domain d1dxrc_: 1dxr C: [19670]
    Other proteins in same PDB: d1dxrh1, d1dxrh2, d1dxrl1, d1dxrm1

Details for d1dxrc_

PDB Entry: 1dxr (more details), 2 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis - his l168 phe mutant (terbutryn complex)

SCOP Domain Sequences for d1dxrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxrc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

SCOP Domain Coordinates for d1dxrc_:

Click to download the PDB-style file with coordinates for d1dxrc_.
(The format of our PDB-style files is described here.)

Timeline for d1dxrc_: