SCOPe 2.05: Domain d4jhga_: 4jhg A:

Lineage for d4jhga_ (4jhg A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (20 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [194255] (5 PDB entries)

8. Domain d4jhga_: 4jhg A: [196690]
   automated match to d1e09a_
   complexed with mli, na, zea

Details for d4jhga_

PDB Entry: 4jhg, 1.85 Å

PDB Description: crystal structure of medicago truncatula nodulin 13 (mtn13) in complex with trans-zeatin

PDB Compounds: (A:) MtN13 protein

SCOPe Domain Sequences for d4jhga_:

Sequence; same for both SEQRES and ATOM records:

>d4jhga_ d.129.3.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]}
idpftmgvitseseyvsslsaeklyrgivedgniiypkalprfiekaetlegdggpgtik
kltfvgdfgstkqhidmvdrencaytysvyegialsdqplekivfefklvptpeegcivk
sttkyytkgddielskdyleagierfegftkavesfllanpdy

Timeline for d4jhga_:

• d4jhga_ first appeared in SCOPe 2.02
  
• d4jhga_ appears in SCOPe 2.04
  
• d4jhga_ is called d4jhga1 in SCOPe 2.06
  
• d4jhga_ appears in the current release, SCOPe 2.08, called d4jhga1