SCOPe 2.03: Domain d4hemf_: 4hem F:

Lineage for d4hemf_ (4hem F:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (60 PDB entries)

8. Domain d4hemf_: 4hem F: [196676]
   Other proteins in same PDB: d4hema1
   automated match to d3qxta_

Details for d4hemf_

PDB Entry: 4hem, 1.65 Å

PDB Description: llama vhh-02 binder of orf49 (rbp) from lactococcal phage tp901-1

PDB Compounds: (F:) Anti-baseplate TP901-1 Llama vHH 02

SCOPe Domain Sequences for d4hemf_:

Sequence; same for both SEQRES and ATOM records:

>d4hemf_ b.1.1.1 (F:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasestfsnyamgwfrqapgperefvatisqtgshtyy
rnsvkgrftisrdnakntvylqmnnmkpedtavyycaagdnyyytrtyeydywgqgtqvt
vs

Timeline for d4hemf_:

• d4hemf_ first appeared in SCOPe 2.02
  
• d4hemf_ appears in SCOPe 2.04
  
• d4hemf_ appears in the current release, SCOPe 2.08