Lineage for d4il6v_ (4il6 V:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304768Protein automated matches [190113] (17 species)
    not a true protein
  7. 2304842Species Thermosynechococcus vulcanus [TaxId:32053] [189921] (1 PDB entry)
  8. 2304843Domain d4il6v_: 4il6 V: [196655]
    Other proteins in same PDB: d4il6a_, d4il6b_, d4il6c_, d4il6d_, d4il6e_, d4il6f_, d4il6h_, d4il6j_, d4il6k_, d4il6l_, d4il6m_, d4il6o_, d4il6u_, d4il6x_, d4il6z_
    automated match to d3bz2v_
    complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl

Details for d4il6v_

PDB Entry: 4il6 (more details), 2.1 Å

PDB Description: structure of sr-substituted photosystem ii
PDB Compounds: (V:) cytochrome c-550

SCOPe Domain Sequences for d4il6v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il6v_ a.3.1.1 (V:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOPe Domain Coordinates for d4il6v_:

Click to download the PDB-style file with coordinates for d4il6v_.
(The format of our PDB-style files is described here.)

Timeline for d4il6v_: