Lineage for d4il6j_ (4il6 J:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631774Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) (S)
    automatically mapped to Pfam PF01788
  5. 2631775Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. 2631785Protein automated matches [191002] (3 species)
    not a true protein
  7. 2631793Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (24 PDB entries)
  8. 2631804Domain d4il6j_: 4il6 J: [196654]
    Other proteins in same PDB: d4il6a_, d4il6b_, d4il6c_, d4il6d_, d4il6e_, d4il6f_, d4il6h_, d4il6k_, d4il6l_, d4il6m_, d4il6o_, d4il6u_, d4il6v_, d4il6x_, d4il6z_
    automated match to d3arcj_
    complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl

Details for d4il6j_

PDB Entry: 4il6 (more details), 2.1 Å

PDB Description: structure of sr-substituted photosystem ii
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d4il6j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il6j_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
eggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d4il6j_:

Click to download the PDB-style file with coordinates for d4il6j_.
(The format of our PDB-style files is described here.)

Timeline for d4il6j_: