| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) ![]() automatically mapped to Pfam PF05151 |
| Family f.23.35.1: PsbM-like [161034] (2 proteins) Pfam PF05151 |
| Protein automated matches [196649] (5 species) not a true protein |
| Species Thermosynechococcus vulcanus [TaxId:32053] [196650] (6 PDB entries) |
| Domain d4il6m_: 4il6 M: [196651] Other proteins in same PDB: d4il6a_, d4il6b_, d4il6c_, d4il6d_, d4il6e_, d4il6f_, d4il6h_, d4il6j_, d4il6k_, d4il6l_, d4il6o_, d4il6u_, d4il6v_, d4il6x_, d4il6z_ automated match to d2axtm1 complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl |
PDB Entry: 4il6 (more details), 2.1 Å
SCOPe Domain Sequences for d4il6m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4il6m_ f.23.35.1 (M:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk
Timeline for d4il6m_: