Lineage for d4il6c_ (4il6 C:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2634050Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 2634051Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 2634052Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 2634071Protein automated matches [191285] (5 species)
    not a true protein
  7. 2634087Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (35 PDB entries)
  8. 2634113Domain d4il6c_: 4il6 C: [196648]
    Other proteins in same PDB: d4il6a_, d4il6d_, d4il6e_, d4il6f_, d4il6h_, d4il6j_, d4il6k_, d4il6l_, d4il6m_, d4il6o_, d4il6u_, d4il6v_, d4il6x_, d4il6z_
    automated match to d3arcc_
    complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl

Details for d4il6c_

PDB Entry: 4il6 (more details), 2.1 Å

PDB Description: structure of sr-substituted photosystem ii
PDB Compounds: (C:) Photosystem II CP43 protein

SCOPe Domain Sequences for d4il6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il6c_ f.55.1.1 (C:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
atnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmy
eqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetlee
yssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnp
tldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarr
afiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdq
klganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikn
diqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghl
whagraraaaagfekgidresepvlsmpsld

SCOPe Domain Coordinates for d4il6c_:

Click to download the PDB-style file with coordinates for d4il6c_.
(The format of our PDB-style files is described here.)

Timeline for d4il6c_: