SCOPe 2.08: Domain d4il6e_: 4il6 E:

Lineage for d4il6e_ (4il6 E:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189913] (22 PDB entries)

8. Domain d4il6e_: 4il6 E: [196645]
   Other proteins in same PDB: d4il6a_, d4il6b_, d4il6c_, d4il6d_, d4il6f_, d4il6h_, d4il6j_, d4il6k_, d4il6l_, d4il6m_, d4il6o_, d4il6u_, d4il6v_, d4il6x_, d4il6z_
   automated match to d3arce_
   complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl
   has additional insertions and/or extensions that are not grouped together

Details for d4il6e_

PDB Entry: 4il6, 2.1 Å

PDB Description: structure of sr-substituted photosystem ii

PDB Compounds: (E:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d4il6e_:

Sequence; same for both SEQRES and ATOM records:

>d4il6e_ f.23.38.1 (E:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus vulcanus [TaxId: 32053]}
ttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsi
plvtdrfeakqqvetfleql

Timeline for d4il6e_:

• d4il6e_ first appeared in SCOPe 2.02
  
• d4il6e_ appears in SCOPe 2.07