Lineage for d4il6f_ (4il6 F:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238840Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 1238841Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 1238851Protein automated matches [191000] (2 species)
    not a true protein
  7. 1238857Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (2 PDB entries)
  8. 1238859Domain d4il6f_: 4il6 F: [196642]
    Other proteins in same PDB: d4il6a_, d4il6b_, d4il6c_, d4il6d_, d4il6e_, d4il6h_, d4il6j_, d4il6k_, d4il6m_, d4il6o_, d4il6u_, d4il6v_, d4il6z_
    automated match to d2axtf1
    complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl

Details for d4il6f_

PDB Entry: 4il6 (more details), 2.1 Å

PDB Description: structure of sr-substituted photosystem ii
PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d4il6f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il6f_ f.23.38.1 (F:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
sypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d4il6f_:

Click to download the PDB-style file with coordinates for d4il6f_.
(The format of our PDB-style files is described here.)

Timeline for d4il6f_: