SCOPe 2.08: Domain d4f0za_: 4f0z A:

Lineage for d4f0za_ (4f0z A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase-2B (PP-2B, calcineurin A subunit) [56313] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56315] (9 PDB entries)

8. Domain d4f0za_: 4f0z A: [196641]
   Other proteins in same PDB: d4f0zb_
   automated match to d1m63a_
   complexed with ca, gol

Details for d4f0za_

PDB Entry: 4f0z, 1.7 Å

PDB Description: Crystal Structure of Calcineurin in Complex with the Calcineurin-Inhibiting Domain of the African Swine Fever Virus Protein A238L

PDB Compounds: (A:) Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform

SCOPe Domain Sequences for d4f0za_:

Sequence; same for both SEQRES and ATOM records:

>d4f0za_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]}
tdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesvalriitegasilr
qeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlyl
walkilypktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnq
qflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntv
rgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyld
vynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvln

Timeline for d4f0za_:

• d4f0za_ first appeared in SCOPe 2.02
  
• d4f0za_ appears in SCOPe 2.07