Lineage for d3zdgg_ (3zdg G:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1140565Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1140566Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1140567Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
  6. 1140620Protein automated matches [190922] (2 species)
    not a true protein
  7. 1140621Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (9 PDB entries)
  8. 1140625Domain d3zdgg_: 3zdg G: [196629]
    automated match to d3u8jb_
    complexed with 1pe, nag, peg, so4, xrx

Details for d3zdgg_

PDB Entry: 3zdg (more details), 2.48 Å

PDB Description: crystal structure of ls-achbp complexed with carbamoylcholine analogue 3-(dimethylamino)butyl dimethylcarbamate (dmabc)
PDB Compounds: (G:) acetylcholine binding protein

SCOPe Domain Sequences for d3zdgg_:

Sequence, based on SEQRES records: (download)

>d3zdgg_ b.96.1.1 (G:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records): (download)

>d3zdgg_ b.96.1.1 (G:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
sccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d3zdgg_:

Click to download the PDB-style file with coordinates for d3zdgg_.
(The format of our PDB-style files is described here.)

Timeline for d3zdgg_: