Class b: All beta proteins [48724] (180 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Protein automated matches [190922] (2 species) not a true protein |
Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries) |
Domain d3zdge_: 3zdg E: [196627] Other proteins in same PDB: d3zdga_, d3zdgb_, d3zdgc_, d3zdgh_, d3zdgi_, d3zdgj_, d3zdgk_, d3zdgl_, d3zdgm_, d3zdgn_, d3zdgo_, d3zdgp_, d3zdgq_, d3zdgr_, d3zdgs_, d3zdgt_ automated match to d3u8jb_ complexed with 1pe, nag, peg, so4, xrx |
PDB Entry: 3zdg (more details), 2.48 Å
SCOPe Domain Sequences for d3zdge_:
Sequence, based on SEQRES records: (download)
>d3zdge_ b.96.1.1 (E:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk nsvtysccpeayedvevslnfrkk
>d3zdge_ b.96.1.1 (E:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty sccpeayedvevslnfrkk
Timeline for d3zdge_: