Lineage for d4ggfs_ (4ggf S:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087624Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1087625Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1087651Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1087845Protein automated matches [190132] (4 species)
    not a true protein
  7. 1087853Species Human (Homo sapiens) [TaxId:9606] [187203] (20 PDB entries)
  8. 1087870Domain d4ggfs_: 4ggf S: [196625]
    automated match to d1mr8a_
    complexed with ca, gol, mn, so4

Details for d4ggfs_

PDB Entry: 4ggf (more details), 1.6 Å

PDB Description: Crystal structure of Mn2+ bound calprotectin
PDB Compounds: (S:) Protein S100-A8

SCOPe Domain Sequences for d4ggfs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ggfs_ a.39.1.2 (S:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
ntdgavnfqeflilvikmgvaahkkshee

SCOPe Domain Coordinates for d4ggfs_:

Click to download the PDB-style file with coordinates for d4ggfs_.
(The format of our PDB-style files is described here.)

Timeline for d4ggfs_: