SCOPe 2.04: Domain d3h5ia_: 3h5i A:

Lineage for d3h5ia_ (3h5i A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (54 species)
   not a true protein

7. Species Carboxydothermus hydrogenoformans [TaxId:246194] [196575] (1 PDB entry)

8. Domain d3h5ia_: 3h5i A: [196576]
   automated match to d3f6pa_
   complexed with cl, na

Details for d3h5ia_

PDB Entry: 3h5i, 1.9 Å

PDB Description: crystal structure of the n-terminal domain of a response regulator/sensory box/ggdef 3-domain protein from carboxydothermus hydrogenoformans

PDB Compounds: (A:) Response regulator/sensory box protein/GGDEF domain protein

SCOPe Domain Sequences for d3h5ia_:

Sequence; same for both SEQRES and ATOM records:

>d3h5ia_ c.23.1.0 (A:) automated matches {Carboxydothermus hydrogenoformans [TaxId: 246194]}
kkilivedskfqaktianilnkygytveialtgeaavekvsggwypdlilmdielgegmd
gvqtalaiqqiselpvvfltahtepavvekirsvtaygyvmksateqvlitivemalrly
eanvh

Timeline for d3h5ia_:

• d3h5ia_ first appeared in SCOPe 2.02
  
• d3h5ia_ appears in SCOPe 2.03
  
• d3h5ia_ appears in SCOPe 2.05
  
• d3h5ia_ appears in the current release, SCOPe 2.08