Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (20 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:1076] [196563] (1 PDB entry) |
Domain d3hina_: 3hin A: [196565] automated match to d3q0jd_ |
PDB Entry: 3hin (more details), 2 Å
SCOPe Domain Sequences for d3hina_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hina_ c.14.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]} aatiadpstlvvdtvgpvltiglnrpkkrnalndglmaalkdcltdipdqiravvihgig dhfsagldlselrerdateglvhsqtwhrvfdkiqycrvpviaalkgaviggglelacaa hirvaeasayyalpegsrgifvggggsvrlprligvarmadmmltgrvysaaegvvhgfs qyliengsaydkalelgnrvaqnapltnfavlqalpmiaeanpqtgllmeslmatvaqsd qeaktrirafldhktakv
Timeline for d3hina_: