Lineage for d3gcea_ (3gce A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309647Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1309648Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1309840Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 1309841Protein automated matches [190701] (8 species)
    not a true protein
  7. 1309895Species Nocardioides aromaticivorans [TaxId:200618] [196555] (2 PDB entries)
  8. 1309896Domain d3gcea_: 3gce A: [196556]
    automated match to d2i7fa_
    complexed with fes

Details for d3gcea_

PDB Entry: 3gce (more details), 2 Å

PDB Description: Ferredoxin of carbazole 1,9a-dioxygenase from Nocardioides aromaticivorans IC177
PDB Compounds: (A:) Ferredoxin component of carbazole 1,9a-dioxygenase

SCOPe Domain Sequences for d3gcea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gcea_ b.33.1.0 (A:) automated matches {Nocardioides aromaticivorans [TaxId: 200618]}
stpvrvatldqlkpgvptafdvdgdevmvvrdgdsvyaisnlcshaeayldmgvfhaesl
eiecplhvgrfdvrtgaptalpcvlpvraydvvvdgteilvapk

SCOPe Domain Coordinates for d3gcea_:

Click to download the PDB-style file with coordinates for d3gcea_.
(The format of our PDB-style files is described here.)

Timeline for d3gcea_: