Lineage for d3gl4b_ (3gl4 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199112Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1199113Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1199567Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1199568Protein automated matches [190526] (11 species)
    not a true protein
  7. Species Anthomedusae sp. [TaxId:328397] [194158] (2 PDB entries)
  8. 1199574Domain d3gl4b_: 3gl4 B: [196551]
    automated match to d3lvca_

Details for d3gl4b_

PDB Entry: 3gl4 (more details), 2.15 Å

PDB Description: X-ray structure of photobleached killerred
PDB Compounds: (B:) KillerRed

SCOPe Domain Sequences for d3gl4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gl4b_ d.22.1.0 (B:) automated matches {Anthomedusae sp. [TaxId: 328397]}
eggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnvhavcetgklpmswkpic
hliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsri
tvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdskm
tfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvpritsaig

SCOPe Domain Coordinates for d3gl4b_:

Click to download the PDB-style file with coordinates for d3gl4b_.
(The format of our PDB-style files is described here.)

Timeline for d3gl4b_: