Lineage for d3iccb_ (3icc B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580234Species Bacillus anthracis [TaxId:261594] [196544] (4 PDB entries)
  8. 1580236Domain d3iccb_: 3icc B: [196546]
    automated match to d3osua_
    complexed with cl, mes, nap, so4

Details for d3iccb_

PDB Entry: 3icc (more details), 1.87 Å

PDB Description: crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution
PDB Compounds: (B:) Putative 3-oxoacyl-(acyl carrier protein) reductase

SCOPe Domain Sequences for d3iccb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iccb_ c.2.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 261594]}
ansmlkgkvalvtgasrgigraiakrlandgalvaihygnrkeeaeetvyeiqsnggsaf
siganleslhgvealyssldnelqnrtgstkfdilinnagigpgafieetteqffdrmvs
vnakapffiiqqalsrlrdnsriinissaatrislpdfiaysmtkgaintmtftlakqlg
argitvnailpgfvktdmnaellsdpmmkqyattisafnrlgevediadtaaflaspdsr
wvtgqlidvsggscl

SCOPe Domain Coordinates for d3iccb_:

Click to download the PDB-style file with coordinates for d3iccb_.
(The format of our PDB-style files is described here.)

Timeline for d3iccb_: