Lineage for d3icca1 (3icc A:1-252)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846008Species Bacillus anthracis [TaxId:261594] [196544] (4 PDB entries)
  8. 2846009Domain d3icca1: 3icc A:1-252 [196545]
    Other proteins in same PDB: d3icca2, d3iccb2
    automated match to d3osua_
    complexed with cl, mes, nap, so4

Details for d3icca1

PDB Entry: 3icc (more details), 1.87 Å

PDB Description: crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution
PDB Compounds: (A:) Putative 3-oxoacyl-(acyl carrier protein) reductase

SCOPe Domain Sequences for d3icca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3icca1 c.2.1.0 (A:1-252) automated matches {Bacillus anthracis [TaxId: 261594]}
mlkgkvalvtgasrgigraiakrlandgalvaihygnrkeeaeetvyeiqsnggsafsig
anleslhgvealyssldnelqnrtgstkfdilinnagigpgafieetteqffdrmvsvna
kapffiiqqalsrlrdnsriinissaatrislpdfiaysmtkgaintmtftlakqlgarg
itvnailpgfvktdmnaellsdpmmkqyattisafnrlgevediadtaaflaspdsrwvt
gqlidvsggscl

SCOPe Domain Coordinates for d3icca1:

Click to download the PDB-style file with coordinates for d3icca1.
(The format of our PDB-style files is described here.)

Timeline for d3icca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3icca2