SCOPe 2.02: Domain d3jvma_: 3jvm A:

Lineage for d3jvma_ (3jvm A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (2 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [196526] (1 PDB entry)

8. Domain d3jvma_: 3jvm A: [196527]
   automated match to d1x0ja_
   complexed with bme, edo

Details for d3jvma_

PDB Entry: 3jvm, 1.2 Å

PDB Description: Crystal structure of bromodomain 2 of mouse Brd4

PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d3jvma_:

Sequence; same for both SEQRES and ATOM records:

>d3jvma_ a.29.2.0 (A:) automated matches {Mus musculus [TaxId: 10090]}
gamgskiseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmsti
ksklesreyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpd

Timeline for d3jvma_:

• d3jvma_ is new in SCOPe 2.02-stable
  
• d3jvma_ appears in SCOPe 2.03
  
• d3jvma_ appears in the current release, SCOPe 2.08, called d3jvma1