Lineage for d3iaja_ (3iaj A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773616Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2773617Protein automated matches [191109] (11 species)
    not a true protein
  7. 2773621Species Clostridium beijerinckii [TaxId:290402] [189152] (7 PDB entries)
  8. 2773649Domain d3iaja_: 3iaj A: [196502]
    automated match to d3i9he_
    complexed with ca

Details for d3iaja_

PDB Entry: 3iaj (more details), 2.1 Å

PDB Description: crystal structure of a betagamma-crystallin domain from clostridium beijerinckii-in alternate space group i422
PDB Compounds: (A:) Beta and gamma crystallin

SCOPe Domain Sequences for d3iaja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iaja_ b.11.1.0 (A:) automated matches {Clostridium beijerinckii [TaxId: 290402]}
kavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftgt
kwtytsdtpwvgndandkmtsvkiyst

SCOPe Domain Coordinates for d3iaja_:

Click to download the PDB-style file with coordinates for d3iaja_.
(The format of our PDB-style files is described here.)

Timeline for d3iaja_: