SCOPe 2.02: Domain d3ks5b_: 3ks5 B:

Lineage for d3ks5b_ (3ks5 B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families)

5. Family c.1.18.0: automated matches [191539] (1 protein)
   not a true family

6. Protein automated matches [190919] (6 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [196495] (2 PDB entries)

8. Domain d3ks5b_: 3ks5 B: [196496]
   automated match to d2pz0b_
   complexed with act, edo, fe

Details for d3ks5b_

PDB Entry: 3ks5, 2.05 Å

PDB Description: crystal structure of putative glycerophosphoryl diester phosphodiesterase (17743486) from agrobacterium tumefaciens str. c58 (dupont) at 2.05 a resolution

PDB Compounds: (B:) Glycerophosphoryl diester phosphodiesterase

SCOPe Domain Sequences for d3ks5b_:

Sequence; same for both SEQRES and ATOM records:

>d3ks5b_ c.1.18.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
gmtriashrggtlefgdstphgftataamaleevefdlhptadgaivvhhdptldattdm
tgaivdmtlakvktatirygagshpmtleelcalyvdshvnfrceikpgvdglpyegfva
lviaglerhsmlerttfssfllasmdelwkattrprlwlvspsvlqqlgpgavietaiah
siheigvhidtadaglmaqvqaagldfgcwaahtpsqitkaldlgvkvfttdrptlaial
rtehrmea

Timeline for d3ks5b_:

• d3ks5b_ is new in SCOPe 2.02-stable
  
• d3ks5b_ appears in SCOPe 2.03
  
• d3ks5b_ appears in the current release, SCOPe 2.08, called d3ks5b1