SCOPe 2.06: Domain d3lmsa_: 3lms A:

Lineage for d3lmsa_ (3lms A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.0: automated matches [191553] (1 protein)
   not a true family

6. Protein automated matches [190955] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [196475] (1 PDB entry)

8. Domain d3lmsa_: 3lms A: [196476]
   Other proteins in same PDB: d3lmsb1, d3lmsb2
   automated match to d3d4ua_
   complexed with ca, cl, gly, gol, k, zn

Details for d3lmsa_

PDB Entry: 3lms, 2.5 Å

PDB Description: structure of human activated thrombin-activatable fibrinolysis inhibitor, tafia, in complex with tick-derived funnelin inhibitor, tci.

PDB Compounds: (A:) Carboxypeptidase B2

SCOPe Domain Sequences for d3lmsa_:

Sequence; same for both SEQRES and ATOM records:

>d3lmsa_ c.56.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asasyyeqyhslneiyswiefiterhpdmltkihigssfekyplyvlkvsgkeqaaknai
widcgiharewispafclwfighitqfygiigqytnllrlvdfyvmpvvnvdgydyswkk
nrmwrknrsfyannhcigtdlnrnfaskhwceegasssscsetycglypesepevkavas
flrrninqikayismhsysqhivfpysytrskskdheelslvaseavraiektskntryt
hghgsetlylapgggddwiydlgikysftielrdtgtygfllperyikptcreafaavsk
iawhvirnv

Timeline for d3lmsa_:

• d3lmsa_ first appeared in SCOPe 2.02
  
• d3lmsa_ appears in SCOPe 2.05
  
• d3lmsa_ appears in SCOPe 2.07
  
• d3lmsa_ appears in the current release, SCOPe 2.08