Lineage for d3lmsa_ (3lms A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1173024Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1173859Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 1174306Family c.56.5.0: automated matches [191553] (1 protein)
    not a true family
  6. 1174307Protein automated matches [190955] (3 species)
    not a true protein
  7. 1174310Species Homo sapiens [TaxId:9606] [196475] (1 PDB entry)
  8. 1174311Domain d3lmsa_: 3lms A: [196476]
    automated match to d3d4ua_
    complexed with ca, cl, gly, gol, k, zn

Details for d3lmsa_

PDB Entry: 3lms (more details), 2.5 Å

PDB Description: structure of human activated thrombin-activatable fibrinolysis inhibitor, tafia, in complex with tick-derived funnelin inhibitor, tci.
PDB Compounds: (A:) Carboxypeptidase B2

SCOPe Domain Sequences for d3lmsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lmsa_ c.56.5.0 (A:) automated matches {Homo sapiens [TaxId: 9606]}
asasyyeqyhslneiyswiefiterhpdmltkihigssfekyplyvlkvsgkeqaaknai
widcgiharewispafclwfighitqfygiigqytnllrlvdfyvmpvvnvdgydyswkk
nrmwrknrsfyannhcigtdlnrnfaskhwceegasssscsetycglypesepevkavas
flrrninqikayismhsysqhivfpysytrskskdheelslvaseavraiektskntryt
hghgsetlylapgggddwiydlgikysftielrdtgtygfllperyikptcreafaavsk
iawhvirnv

SCOPe Domain Coordinates for d3lmsa_:

Click to download the PDB-style file with coordinates for d3lmsa_.
(The format of our PDB-style files is described here.)

Timeline for d3lmsa_: