Class g: Small proteins [56992] (90 folds) |
Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) |
Family g.44.1.0: automated matches [191345] (1 protein) not a true family |
Protein automated matches [190242] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189860] (2 PDB entries) |
Domain d3lrqd_: 3lrq D: [196465] automated match to d2y43b_ complexed with zn |
PDB Entry: 3lrq (more details), 2.29 Å
SCOPe Domain Sequences for d3lrqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lrqd_ g.44.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdeqsvesiaevfrcficmeklrdarlcphcsklccfscirrwlteqraqcphcraplql relvncrwaeevtqqldtlqlcsl
Timeline for d3lrqd_: