Lineage for d3k2mb_ (3k2m B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206459Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2206460Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2206461Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2206888Protein automated matches [190202] (4 species)
    not a true protein
  7. 2206893Species Human (Homo sapiens) [TaxId:9606] [186949] (18 PDB entries)
  8. 2206897Domain d3k2mb_: 3k2m B: [196464]
    Other proteins in same PDB: d3k2mc_, d3k2md_
    automated match to d3uyoa_
    complexed with po4

Details for d3k2mb_

PDB Entry: 3k2m (more details), 1.75 Å

PDB Description: crystal structure of monobody ha4/abl1 sh2 domain complex
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d3k2mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k2mb_ d.93.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintasdg
klyvssesrfntlaelvhhhstvadglittlhypapk

SCOPe Domain Coordinates for d3k2mb_:

Click to download the PDB-style file with coordinates for d3k2mb_.
(The format of our PDB-style files is described here.)

Timeline for d3k2mb_: