SCOPe 2.02: Domain d3n5md_: 3n5m D:

Lineage for d3n5md_ (3n5m D:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (34 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:1392] [196443] (1 PDB entry)

8. Domain d3n5md_: 3n5m D: [196444]
   automated match to d3drda_
   complexed with cl, so4

Details for d3n5md_

PDB Entry: 3n5m, 2.05 Å

PDB Description: crystals structure of a bacillus anthracis aminotransferase

PDB Compounds: (D:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

SCOPe Domain Sequences for d3n5md_:

Sequence; same for both SEQRES and ATOM records:

>d3n5md_ c.67.1.0 (D:) automated matches {Bacillus anthracis [TaxId: 1392]}
namktkqtdellakdeqyvwhgmrpfspnsttvgakaegcwvediqgkryldgmsglwcv
nsgygrkelaeaaykqlqtlsyfpmsqshepaiklaeklnewlggeyviffsnsgseane
tafkiarqyyaqkgephrykfmsryrgyhgntmatmaatgqaqrryqyepfasgflhvtp
pdcyrmpgiereniydvecvkevdrvmtwelsetiaafimepiitgggilmapqdymkav
hetcqkhgallisdevicgfgrtgkafgfmnydvkpdiitmakgitsaylplsatavkre
iyeafkgkgeyeffrhintfggnpaacalalknleiienenliersaqmgsllleqlkee
igehplvgdirgkgllvgielvndketkepidndkiasvvnackekgliigrngmttagy
nniltlapplvisseeiafvigtlktameri

Timeline for d3n5md_:

• d3n5md_ is new in SCOPe 2.02-stable
  
• d3n5md_ appears in SCOPe 2.03
  
• d3n5md_ appears in the current release, SCOPe 2.08, called d3n5md1