Lineage for d3ndob_ (3ndo B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1147695Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1148735Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1148736Protein automated matches [190115] (32 species)
    not a true protein
  7. 1148904Species Mycobacterium smegmatis [TaxId:1772] [196434] (1 PDB entry)
  8. 1148905Domain d3ndob_: 3ndo B: [196435]
    automated match to d3ng3a_
    complexed with gol, nh4, unl

Details for d3ndob_

PDB Entry: 3ndo (more details), 1.25 Å

PDB Description: crystal structure of deoxyribose phosphate aldolase from mycobacterium smegmatis
PDB Compounds: (B:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d3ndob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ndob_ c.1.10.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
dhtraqvaalvdhtllkpeatpsdvtalvdeaadlgvfavcvspplvsvaagvapsglai
aavagfpsgkhvpgikateaelavaagateidmvidvgaalagdldavsaditavrkavr
aatlkvivesaallefsgeplladvcrvardagadfvktstgfhpsggasvqaveimart
vgerlgvkasggirtaeqaaamldagatrlglsgsravldgfgsa

SCOPe Domain Coordinates for d3ndob_:

Click to download the PDB-style file with coordinates for d3ndob_.
(The format of our PDB-style files is described here.)

Timeline for d3ndob_: