Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (32 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:1772] [196434] (1 PDB entry) |
Domain d3ndob_: 3ndo B: [196435] automated match to d3ng3a_ complexed with gol, nh4, unl |
PDB Entry: 3ndo (more details), 1.25 Å
SCOPe Domain Sequences for d3ndob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ndob_ c.1.10.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 1772]} dhtraqvaalvdhtllkpeatpsdvtalvdeaadlgvfavcvspplvsvaagvapsglai aavagfpsgkhvpgikateaelavaagateidmvidvgaalagdldavsaditavrkavr aatlkvivesaallefsgeplladvcrvardagadfvktstgfhpsggasvqaveimart vgerlgvkasggirtaeqaaamldagatrlglsgsravldgfgsa
Timeline for d3ndob_: