SCOPe 2.02: Domain d3n1ia_: 3n1i A:

Lineage for d3n1ia_ (3n1i A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
   helix-swapped dimer of beta(4)-alpha motifs

4. Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families)

5. Family d.18.1.0: automated matches [191638] (1 protein)
   not a true family

6. Protein automated matches [191174] (1 species)
   not a true protein

7. Species Potato (Solanum tuberosum) [TaxId:4113] [189417] (8 PDB entries)

8. Domain d3n1ia_: 3n1i A: [196433]
   automated match to d3r9za_
   protein/DNA complex

Details for d3n1ia_

PDB Entry: 3n1i, 2.2 Å

PDB Description: crystal structure of a stwhy2-ere32 complex

PDB Compounds: (A:) protein StWhy2

SCOPe Domain Sequences for d3n1ia_:

Sequence; same for both SEQRES and ATOM records:

>d3n1ia_ d.18.1.0 (A:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]}
grvfapysvfkgkaalsaeprlptfnrldsggvklnrrgvimltfwpsvgerkydwekrq
lfalsatevgslismgtrdsseffhdpsmlssnagqvrkslsikpnadgsgyfislsvvn
nnlktndrftvpvttaefavmrtafsfalphimgwdrftnr

Timeline for d3n1ia_:

• d3n1ia_ is new in SCOPe 2.02-stable
  
• d3n1ia_ appears in SCOPe 2.03
  
• d3n1ia_ appears in the current release, SCOPe 2.08