Lineage for d3nxqb_ (3nxq B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2206178Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2206179Protein automated matches [190805] (17 species)
    not a true protein
  7. 2206207Species Human (Homo sapiens) [TaxId:9606] [188286] (43 PDB entries)
  8. 2206227Domain d3nxqb_: 3nxq B: [196425]
    automated match to d2xyda_
    complexed with cl, p6g, peg, pg4, rx4, zn; mutant

Details for d3nxqb_

PDB Entry: 3nxq (more details), 1.99 Å

PDB Description: Angiotensin Converting Enzyme N domain glycsoylation mutant (Ndom389) in complex with RXP407
PDB Compounds: (B:) angiotensin-converting enzyme

SCOPe Domain Sequences for d3nxqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nxqb_ d.92.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
iystakvclpqktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
pplpdnypeg

SCOPe Domain Coordinates for d3nxqb_:

Click to download the PDB-style file with coordinates for d3nxqb_.
(The format of our PDB-style files is described here.)

Timeline for d3nxqb_: