SCOPe 2.02: Domain d3ag7a_: 3ag7 A:

Lineage for d3ag7a_ (3ag7 A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.0: automated matches [191473] (1 protein)
   not a true family

6. Protein automated matches [190750] (3 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [196421] (1 PDB entry)

8. Domain d3ag7a_: 3ag7 A: [196422]
   automated match to d1nz6a_

Details for d3ag7a_

PDB Entry: 3ag7, 1.8 Å

PDB Description: An auxilin-like J-domain containing protein, JAC1 J-domain

PDB Compounds: (A:) Putative uncharacterized protein F9E10.5

SCOPe Domain Sequences for d3ag7a_:

Sequence; same for both SEQRES and ATOM records:

>d3ag7a_ a.2.3.0 (A:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
gplgseeiknidakirkwssgksgnirsllstlqyilwsgsgwkpvplmdmiegnavrks
yqrallilhpdklqqkgasanqkymaekvfellqeawdhfntlgp

Timeline for d3ag7a_:

• d3ag7a_ is new in SCOPe 2.02-stable
  
• d3ag7a_ appears in SCOPe 2.03
  
• d3ag7a_ appears in the current release, SCOPe 2.08, called d3ag7a1