SCOPe 2.02: Domain d3omub_: 3omu B:

Lineage for d3omub_ (3omu B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (6 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [189431] (2 PDB entries)

8. Domain d3omub_: 3omu B: [196407]
   automated match to d3o6oa_
   complexed with ibd

Details for d3omub_

PDB Entry: 3omu, 2.15 Å

PDB Description: crystal structure of the n-terminal domain of an hsp90 from trypanosoma brucei, tb10.26.1080 in the presence of a thienopyrimidine derivative

PDB Compounds: (B:) Heat shock protein 83

SCOPe Domain Sequences for d3omub_:

Sequence, based on SEQRES records:

>d3omub_ d.122.1.1 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdeph
lrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqfg
vgfysaylvadrvtvvsknneddaytwessaggtftvtstpdcdlkrgtrivlhlkedqq
eyleerrlkdlikkhsefigydielm

Sequence, based on observed residues (ATOM records):

>d3omub_ d.122.1.1 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdhlr
irvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqfgvg
fysaylvadrvtvvsknneddaytwesgtftvtstpdcdlkrgtrivlhlkedqqeylee
rrlkdlikkhsigydielm

Timeline for d3omub_:

• d3omub_ is new in SCOPe 2.02-stable
  
• d3omub_ appears in SCOPe 2.03
  
• d3omub_ appears in the current release, SCOPe 2.08