Lineage for d3mywi_ (3myw I:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1459078Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1460483Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) (S)
  5. 1460484Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 1460512Protein automated matches [192457] (2 species)
    not a true protein
  7. 1460516Species Vigna radiata [TaxId:3916] [196395] (1 PDB entry)
  8. 1460517Domain d3mywi_: 3myw I: [196396]
    Other proteins in same PDB: d3mywa_, d3mywb_
    automated match to d2r33a1
    complexed with ca

Details for d3mywi_

PDB Entry: 3myw (more details), 2.5 Å

PDB Description: the bowman-birk type inhibitor from mung bean in ternary complex with porcine trypsin
PDB Compounds: (I:) Bowman-Birk type trypsin inhibitor

SCOPe Domain Sequences for d3mywi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mywi_ g.3.13.1 (I:) automated matches {Vigna radiata [TaxId: 3916]}
ccdscdctkskppqchcanirlnschsackscictrsmpgkcrcldtddfcykpc

SCOPe Domain Coordinates for d3mywi_:

Click to download the PDB-style file with coordinates for d3mywi_.
(The format of our PDB-style files is described here.)

Timeline for d3mywi_: