Lineage for d1a0rg_ (1a0r G:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544787Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)
    not a true fold
  4. 544831Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
  5. 544832Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)
  6. 544833Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 544834Species Cow (Bos taurus) [TaxId:9913] [48673] (9 PDB entries)
  8. 544843Domain d1a0rg_: 1a0r G: [19639]
    Other proteins in same PDB: d1a0rb_, d1a0rp_
    complexed with ace, far

Details for d1a0rg_

PDB Entry: 1a0r (more details), 2.8 Å

PDB Description: heterotrimeric complex of phosducin/transducin beta-gamma

SCOP Domain Sequences for d1a0rg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0rg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus)}
pviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgipedk
npfke

SCOP Domain Coordinates for d1a0rg_:

Click to download the PDB-style file with coordinates for d1a0rg_.
(The format of our PDB-style files is described here.)

Timeline for d1a0rg_: