Lineage for d2xuah_ (2xua H:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1617684Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1617685Protein automated matches [190543] (56 species)
    not a true protein
  7. 1617758Species Burkholderia xenovorans [TaxId:266265] [196380] (1 PDB entry)
  8. 1617760Domain d2xuah_: 2xua H: [196381]
    automated match to d3om8b_
    complexed with shf

Details for d2xuah_

PDB Entry: 2xua (more details), 1.9 Å

PDB Description: crystal structure of the enol-lactonase from burkholderia xenovorans lb400
PDB Compounds: (H:) 3-oxoadipate enol-lactonase

SCOPe Domain Sequences for d2xuah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xuah_ c.69.1.0 (H:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
mpyaavngtelhyridgerhgnapwivlsnslgtdlsmwapqvaalskhfrvlrydtrgh
ghseapkgpytieqltgdvlglmdtlkiaranfcglsmggltgvalaarhadriervalc
ntaarigspevwvpravkartegmhaladavlprwftadymerepvvlamirdvfvhtdk
egyasnceaidaadlrpeapgikvpalvisgthdlaatpaqgrelaqaiagaryveldas
hisnieradaftktvvdflte

SCOPe Domain Coordinates for d2xuah_:

Click to download the PDB-style file with coordinates for d2xuah_.
(The format of our PDB-style files is described here.)

Timeline for d2xuah_: