SCOPe 2.05: Domain d1b9xb_: 1b9x B:

Lineage for d1b9xb_ (1b9x B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle
   automatically mapped to Pfam PF00631

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (20 PDB entries)

8. Domain d1b9xb_: 1b9x B: [19638]
   Other proteins in same PDB: d1b9xa_, d1b9xc_
   complexed with gd

Details for d1b9xb_

PDB Entry: 1b9x, 3 Å

PDB Description: structural analysis of phosducin and its phosphorylation-regulated interaction with transducin

PDB Compounds: (B:) protein (transducin)

SCOPe Domain Sequences for d1b9xb_:

Sequence; same for both SEQRES and ATOM records:

>d1b9xb_ a.137.3.1 (B:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
mpviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
knpfkelk

Timeline for d1b9xb_:

• d1b9xb_ first appeared (with stable ids) in SCOP 1.55
  
• d1b9xb_ appears in SCOPe 2.04
  
• d1b9xb_ appears in SCOPe 2.06
  
• d1b9xb_ appears in the current release, SCOPe 2.08