SCOPe 2.03: Domain d3lrgb_: 3lrg B:

Lineage for d3lrgb_ (3lrg B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (75 PDB entries)

8. Domain d3lrgb_: 3lrg B: [196375]
   automated match to d3lrho_
   complexed with imd, trs

Details for d3lrgb_

PDB Entry: 3lrg, 2.05 Å

PDB Description: Structure of anti-huntingtin VL domain

PDB Compounds: (B:) anti-huntingtin VL domain

SCOPe Domain Sequences for d3lrgb_:

Sequence; same for both SEQRES and ATOM records:

>d3lrgb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqspsvsaaprqrvtisvsgsnsnigsntvnwiqqlpgrapellmydddllapgvsdr
fsgsrsgtsasltisglqsedeadyyaatwddslngwvfgggtkvtvls

Timeline for d3lrgb_:

• d3lrgb_ first appeared in SCOPe 2.02
  
• d3lrgb_ appears in SCOPe 2.04
  
• d3lrgb_ appears in the current release, SCOPe 2.08, called d3lrgb1