Lineage for d3mgfd_ (3mgf D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199112Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1199113Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1199567Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1199568Protein automated matches [190526] (11 species)
    not a true protein
  7. 1199676Species Verrillofungia concinna [TaxId:496660] [196369] (1 PDB entry)
  8. 1199677Domain d3mgfd_: 3mgf D: [196370]
    automated match to d2a46a_

Details for d3mgfd_

PDB Entry: 3mgf (more details), 1.8 Å

PDB Description: Crystal Structure of Monomeric Kusabira-Orange (MKO), Orange-Emitting GFP-like Protein, at pH 7.5
PDB Compounds: (D:) fluorescent protein

SCOPe Domain Sequences for d3mgfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mgfd_ d.22.1.0 (D:) automated matches {Verrillofungia concinna [TaxId: 496660]}
svikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvsh
vfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhksk
ftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyka
akkilkmpgshyishrlvrktegnitelvedavahs

SCOPe Domain Coordinates for d3mgfd_:

Click to download the PDB-style file with coordinates for d3mgfd_.
(The format of our PDB-style files is described here.)

Timeline for d3mgfd_: