Lineage for d3mwmb_ (3mwm B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722860Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1722861Protein automated matches [190154] (57 species)
    not a true protein
  7. 1723225Species Streptomyces coelicolor [TaxId:1902] [196367] (2 PDB entries)
  8. 1723229Domain d3mwmb_: 3mwm B: [196368]
    automated match to d2o03a_
    complexed with zn

Details for d3mwmb_

PDB Entry: 3mwm (more details), 2.4 Å

PDB Description: graded expression of zinc-responsive genes through two regulatory zinc-binding sites in zur
PDB Compounds: (B:) Putative metal uptake regulation protein

SCOPe Domain Sequences for d3mwmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mwmb_ a.4.5.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
ratrqraavsaalqeveefrsaqelhdmlkhkgdavglttvyrtlqsladagevdvlrta
egesvyrrcstgdhhhhlvcracgkavevegpavekwaeaiaaehgyvnvahtveifgtc
adcag

SCOPe Domain Coordinates for d3mwmb_:

Click to download the PDB-style file with coordinates for d3mwmb_.
(The format of our PDB-style files is described here.)

Timeline for d3mwmb_: