SCOPe 2.02: Domain d3qy4a_: 3qy4 A:

Lineage for d3qy4a_ (3qy4 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)

6. Protein automated matches [190299] (5 species)
   not a true protein

7. Species Gallus gallus [TaxId:9031] [196365] (1 PDB entry)

8. Domain d3qy4a_: 3qy4 A: [196366]
   automated match to d2vb1a1

Details for d3qy4a_

PDB Entry: 3qy4, 1.65 Å

PDB Description: Crystallization and in situ data collection of Lysozyme using the Crystal Former

PDB Compounds: (A:) Lysozyme C

SCOPe Domain Sequences for d3qy4a_:

Sequence; same for both SEQRES and ATOM records:

>d3qy4a_ d.2.1.2 (A:) automated matches {Gallus gallus [TaxId: 9031]}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgrtpgssnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
qawirgcra

Timeline for d3qy4a_:

• d3qy4a_ is new in SCOPe 2.02-stable
  
• d3qy4a_ appears in SCOPe 2.03
  
• d3qy4a_ appears in the current release, SCOPe 2.08