Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries) |
Domain d3qrjb1: 3qrj B:246-497 [196348] Other proteins in same PDB: d3qrja2, d3qrjb2 automated match to d2gqga_ complexed with 919; mutant |
PDB Entry: 3qrj (more details), 1.82 Å
SCOPe Domain Sequences for d3qrjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qrjb1 d.144.1.7 (B:246-497) automated matches {Human (Homo sapiens) [TaxId: 9606]} hklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmkeikhpnlvqllgvc treppfyiiiefmtygnlldylrecnrqevnavvllymatqissameylekknfihrdla arnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiksdvwaf gvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrps faeihqafetmf
Timeline for d3qrjb1: