Lineage for d3s8ya_ (3s8y A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902605Species Oleispira antarctica [TaxId:188908] [196342] (3 PDB entries)
  8. 2902606Domain d3s8ya_: 3s8y A: [196343]
    automated match to d3ls2a_
    complexed with br

Details for d3s8ya_

PDB Entry: 3s8y (more details), 2.1 Å

PDB Description: Bromide soaked structure of an esterase from the oil-degrading bacterium Oleispira antarctica
PDB Compounds: (A:) Esterase APC40077

SCOPe Domain Sequences for d3s8ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s8ya_ c.69.1.0 (A:) automated matches {Oleispira antarctica [TaxId: 188908]}
sienlssnksfggwhkqyshvsntlncamrfaiylppqastgakvpvlywlsgltcsden
fmqkagaqrlaaelgiaivapdtsprgegvaddegydlgqgagfyvnatqapwnrhyqmy
dyvvnelpeliesmfpvsdkraiaghsmgghgaltialrnperyqsvsafspinnpvncp
wgqkaftaylgkdtdtwreydasllmraakqyvpalvdqgeadnflaeqlkpevleaaas
snnyplelrshegydhsyyfiasfiedhlrfhsnyln

SCOPe Domain Coordinates for d3s8ya_:

Click to download the PDB-style file with coordinates for d3s8ya_.
(The format of our PDB-style files is described here.)

Timeline for d3s8ya_: