Lineage for d3nv7a_ (3nv7 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590710Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1590711Protein automated matches [190459] (36 species)
    not a true protein
  7. 1590803Species Helicobacter pylori [TaxId:85962] [193641] (2 PDB entries)
  8. 1590804Domain d3nv7a_: 3nv7 A: [196331]
    automated match to d1gn8a_
    complexed with acy, so4; mutant

Details for d3nv7a_

PDB Entry: 3nv7 (more details), 1.75 Å

PDB Description: Crystal structure of H.pylori phosphopantetheine adenylyltransferase mutant I4V/N76Y
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3nv7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nv7a_ c.26.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
kvgiypgtfdpvtnghidiihrsselfeklivavahssaknpmfslderlkmiqlatksf
knvecvafegllaylakeyhckvlvrglrvvsdfeyelqmgyankslnheletlyfmptl
qnafisssivrsiiahkgdashlvpkeiypliska

SCOPe Domain Coordinates for d3nv7a_:

Click to download the PDB-style file with coordinates for d3nv7a_.
(The format of our PDB-style files is described here.)

Timeline for d3nv7a_: