SCOPe 2.02: Domain d3sbwb_: 3sbw B:

Lineage for d3sbwb_ (3sbw B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101511] (5 PDB entries)

8. Domain d3sbwb_: 3sbw B: [196327]
   automated match to d1npua_
   mutant

Details for d3sbwb_

PDB Entry: 3sbw, 2.28 Å

PDB Description: crystal structure of the complex between the extracellular domains of mouse pd-1 mutant and human pd-l1

PDB Compounds: (B:) Programmed cell death protein 1

SCOPe Domain Sequences for d3sbwb_:

Sequence; same for both SEQRES and ATOM records:

>d3sbwb_ b.1.1.1 (B:) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]}
sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpklkieespgaelvvt

Timeline for d3sbwb_:

• d3sbwb_ is new in SCOPe 2.02-stable
  
• d3sbwb_ appears in SCOPe 2.03
  
• d3sbwb_ appears in the current release, SCOPe 2.08