SCOPe 2.08: Domain d1vtnc1: 1vtn C:117-217

Lineage for d1vtnc1 (1vtn C:117-217)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)

6. Protein automated matches [190243] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187016] (11 PDB entries)

8. Domain d1vtnc1: 1vtn C:117-217 [196324]
   Other proteins in same PDB: d1vtnc2
   automated match to d1d5va_
   protein/DNA complex; complexed with mg

Details for d1vtnc1

PDB Entry: 1vtn, 2.5 Å

PDB Description: co-crystal structure of the hnf-3/fork head dna-recognition motif resembles histone h5

PDB Compounds: (C:) hnf-3/fork head DNA-recognition motif

SCOPe Domain Sequences for d1vtnc1:

Sequence; same for both SEQRES and ATOM records:

>d1vtnc1 a.4.5.14 (C:117-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hakppysyislitmaiqqapgkmltlseiyqwimdlfpyyrenqqrwqnsirhslsfndc
fvkvarspdkpgkgsywalhpssgnmfengcylrrqkrfkl

Timeline for d1vtnc1:

• d1vtnc1 first appeared in SCOPe 2.02, called d1vtnc_
  
• d1vtnc1 was called d1vtnc_ in SCOPe 2.07