SCOP 1.65: Domain d1tbgg_: 1tbg G:

Lineage for d1tbgg_ (1tbg G:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (9 superfamilies)
   not a true fold

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (9 PDB entries)

8. Domain d1tbgg_: 1tbg G: [19632]
   Other proteins in same PDB: d1tbga_, d1tbgb_, d1tbgc_, d1tbgd_

Details for d1tbgg_

PDB Entry: 1tbg, 2.1 Å

PDB Description: beta-gamma dimer of the heterotrimeric g-protein transducin

SCOP Domain Sequences for d1tbgg_:

Sequence; same for both SEQRES and ATOM records:

>d1tbgg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus)}
apviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
knpfk

Timeline for d1tbgg_:

• d1tbgg_ first appeared (with stable ids) in SCOP 1.55
  
• d1tbgg_ appears in SCOP 1.63
  
• d1tbgg_ appears in SCOP 1.67
  
• d1tbgg_ appears in the current release, SCOPe 2.08