SCOPe 2.06: Domain d1tbgf_: 1tbg F:

Lineage for d1tbgf_ (1tbg F:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle
   automatically mapped to Pfam PF00631

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (28 PDB entries)

8. Domain d1tbgf_: 1tbg F: [19631]
   Other proteins in same PDB: d1tbga_, d1tbgb_, d1tbgc_, d1tbgd_

Details for d1tbgf_

PDB Entry: 1tbg, 2.1 Å

PDB Description: beta-gamma dimer of the heterotrimeric g-protein transducin

PDB Compounds: (F:) transducin

SCOPe Domain Sequences for d1tbgf_:

Sequence; same for both SEQRES and ATOM records:

>d1tbgf_ a.137.3.1 (F:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
apviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
knpfk

Timeline for d1tbgf_:

• d1tbgf_ first appeared (with stable ids) in SCOP 1.55
  
• d1tbgf_ appears in SCOPe 2.05
  
• d1tbgf_ appears in SCOPe 2.07
  
• d1tbgf_ appears in the current release, SCOPe 2.08