Lineage for d3aoka_ (3aok A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117849Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 1117850Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 1117851Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
  6. 1117913Protein automated matches [190195] (4 species)
    not a true protein
  7. 1117914Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [186982] (25 PDB entries)
  8. 1117923Domain d3aoka_: 3aok A: [196305]
    automated match to d1rqwa_
    complexed with gol, tla

Details for d3aoka_

PDB Entry: 3aok (more details), 1.27 Å

PDB Description: Crystal structure of sweet-tasting protein thaumatin II
PDB Compounds: (A:) Thaumatin-2

SCOPe Domain Sequences for d3aoka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aoka_ b.25.1.1 (A:) automated matches {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
sgrgicrtgdcggllqckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d3aoka_:

Click to download the PDB-style file with coordinates for d3aoka_.
(The format of our PDB-style files is described here.)

Timeline for d3aoka_: