Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (15 species) not a true protein |
Species Llama glama [TaxId:9844] [196291] (2 PDB entries) |
Domain d3qxve_: 3qxv E: [196292] automated match to d3qxta_ complexed with mtx, so4 |
PDB Entry: 3qxv (more details), 2.5 Å
SCOPe Domain Sequences for d3qxve_:
Sequence, based on SEQRES records: (download)
>d3qxve_ b.1.1.1 (E:) automated matches {Llama glama [TaxId: 9844]} vqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlttyg dsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqvt v
>d3qxve_ b.1.1.1 (E:) automated matches {Llama glama [TaxId: 9844]} vqlvesgqaggslrlscaasrrssrswamawfrakerefvakisgdgrlttygdsvkgrf tisrdnaeylvylqmdlkpedtavyycaaddnyvtaswrsgpdywgqgtqvtv
Timeline for d3qxve_: