Lineage for d3qxve_ (3qxv E:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105645Protein automated matches [190119] (15 species)
    not a true protein
  7. 1105799Species Llama glama [TaxId:9844] [196291] (2 PDB entries)
  8. 1105801Domain d3qxve_: 3qxv E: [196292]
    automated match to d3qxta_
    complexed with mtx, so4

Details for d3qxve_

PDB Entry: 3qxv (more details), 2.5 Å

PDB Description: Structure of an Anti-Methotrexate CDR1-4 Graft VHH Antibody in Complex with Methotrexate
PDB Compounds: (E:) Anti-Methotrexate CDR1-4 Graft VHH

SCOPe Domain Sequences for d3qxve_:

Sequence, based on SEQRES records: (download)

>d3qxve_ b.1.1.1 (E:) automated matches {Llama glama [TaxId: 9844]}
vqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlttyg
dsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqvt
v

Sequence, based on observed residues (ATOM records): (download)

>d3qxve_ b.1.1.1 (E:) automated matches {Llama glama [TaxId: 9844]}
vqlvesgqaggslrlscaasrrssrswamawfrakerefvakisgdgrlttygdsvkgrf
tisrdnaeylvylqmdlkpedtavyycaaddnyvtaswrsgpdywgqgtqvtv

SCOPe Domain Coordinates for d3qxve_:

Click to download the PDB-style file with coordinates for d3qxve_.
(The format of our PDB-style files is described here.)

Timeline for d3qxve_: